PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.4KG306300.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 421aa    MW: 44123.9 Da    PI: 7.4749
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.4KG306300.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS297.63.2e-91414202374
                 GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                          ++l+l+ A+ ++ gdl +a+++   l   asp++d+  Rla +f++ALa r    +  ++ a  +          + aa+ +f+++ P+l
  Pavir.4KG306300.3.p  41 RDLVLASADLLQRGDLPAARRAAGVLLSAASPRADAADRLAYHFARALALRADAAGRVVAPAGLVP----AARPASSAAYLAFNQIAPFL 126
                          6789999*********************************************99555444443333....335677788999******** PP

                 GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp...egppslRiTgvgspesgskeeleetgerLakfAeelgvpfef 178
                          +f+hltaNqaIl+aveg++rvHi+D+d+ +G+QWp+Llqa+a+R+   +gpp++RiTg g+    ++++l +tg+rL+ fA+++++pf+f
  Pavir.4KG306300.3.p 127 RFAHLTANQAILDAVEGARRVHILDLDAAHGVQWPPLLQAIAERAdpaAGPPEVRITGAGA----DRDTLLRTGSRLRAFARSIQLPFHF 212
                          ********************************************988888***********....9************************ PP

                 GRAS 179 nvl...............vakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnse.. 251
                          ++l                +++ ++  + +L+++p+E+laVn+++ lh+l    +  ++e  ++Lk vk + P vv+++e+e+  ++   
  Pavir.4KG306300.3.p 213 TPLllssaatqhqpvaggSTTTASSEATTSLDLHPDETLAVNCIMFLHKLG---G--QDEVAAFLKWVKAMAPAVVTIAERETVGGGYdr 297
                          ***998888888876665445566668999********************8...2..233578*******************65544334 PP

                 GRAS 252 ..sFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqakl 339
                            ++ +r + a+++ysa+f++lea++p+ s+er  vE+e+lgrei+ ++  +g +     + le+W ++ ++aGF + pls +a++qa+l
  Pavir.4KG306300.3.p 298 idDLPQRAAVAMDHYSAVFEALEATVPPGSRERLAVEQEVLGREIEAALGPAGGR---WWRGLERWGAAARAAGFAARPLSAFAVSQARL 384
                          459***********************************************99987...7899**************************** PP

                 GRAS 340 llrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                          llr ++ s+gy ++e +g+ +lgW++rpL+svS+W+
  Pavir.4KG306300.3.p 385 LLRLHYpSEGYLLQEARGACFLGWQTRPLLSVSSWQ 420
                          ***********************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098550.85314399IPR005202Transcription factor GRAS
PfamPF035141.1E-8841420IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010014Biological Processmeristem initiation
GO:0010223Biological Processsecondary shoot formation
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 421 aa     Download sequence    Send to blast
MLGSLHHHSS SSSDTDNNND NKSSGGGGGG VLAAAAAPSA RDLVLASADL LQRGDLPAAR  60
RAAGVLLSAA SPRADAADRL AYHFARALAL RADAAGRVVA PAGLVPAARP ASSAAYLAFN  120
QIAPFLRFAH LTANQAILDA VEGARRVHIL DLDAAHGVQW PPLLQAIAER ADPAAGPPEV  180
RITGAGADRD TLLRTGSRLR AFARSIQLPF HFTPLLLSSA ATQHQPVAGG STTTASSEAT  240
TSLDLHPDET LAVNCIMFLH KLGGQDEVAA FLKWVKAMAP AVVTIAERET VGGGYDRIDD  300
LPQRAAVAMD HYSAVFEALE ATVPPGSRER LAVEQEVLGR EIEAALGPAG GRWWRGLERW  360
GAAARAAGFA ARPLSAFAVS QARLLLRLHY PSEGYLLQEA RGACFLGWQT RPLLSVSSWQ  420
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-506842031375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP8765580.0KP876558.1 Saccharum hybrid cultivar ROC22 monoculm 1 (MOC1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004965904.20.0PREDICTED: protein MONOCULM 1-like
RefseqXP_012700859.10.0PREDICTED: protein MONOCULM 1-like
SwissprotQ84MM90.0MOC_ORYSJ; Protein MONOCULM 1
TrEMBLK3Y1K30.0K3Y1K3_SETIT; Uncharacterized protein
STRINGSi008068m0.0(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G55580.11e-72GRAS family protein